Protein coding transcript 130916

• Transcript: Ll_transcript_61928
• CDS coordinates: 1-324 (-)
• Peptide sequence: MRIGIPLTDEDREPWLESLRDAVRERIINKTGVILGCSALKKKYREILRSADPDYEWGSYASAVNFVLLDAPAEVLSIRLNKRAAEGKHYMPASLLQSQLDLLEIDES
• ORF Type: 3prime_partial

Annotations of Ll_transcript_61928

• Blastp: Thermosensitive gluconokinase from Escherichia with 45.71% of identity
• Blastx: Gluconokinase from Gluconobacter with 46.73% of identity
• Eggnog: carbohydrate kinase, thermoresistant glucokinase family(COG3265)
• Kegg: Link to kegg annotations (JW4225)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019422259.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;