Protein coding transcript 130917

• Transcript: Ll_transcript_61937
• CDS coordinates: 1-384 (+)
• Peptide sequence: QDFTVAELKKYDGNQEDGRVLVAVNGNVYDVTKGKKFYGPGGPYAAFGGKDASRGLATFQVSAKEEEYDDLSDLNSFEMESVREWEMQFKEKYELVGKLLKPGEAHNSYSDEEDEPTNAGDQKSKDE*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_61937

• Blastp: Membrane-associated progesterone receptor component 2 from Rattus with 64.66% of identity
• Blastx: Membrane-associated progesterone receptor component 2 from Rattus with 64.66% of identity
• Eggnog: progesterone receptor membrane component(ENOG4111UG0)
• Kegg: Link to kegg annotations (361940)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_013469690.1)
• Pfam: Cytochrome b5-like Heme/Steroid binding domain (PF00173.27)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;