Protein coding transcript 130930

• Transcript: Ll_transcript_150968
• CDS coordinates: 3-398 (+)
• Peptide sequence: YVLTDASILLLKENPFSMTPFLHAVLDPILIKPWYHLSVWFKNDDPTPFEKTHGMTFWDYAGLDPNLNHLFNDAMASDARFVSSLLIEKYKESFQGFESLVDVGGGTGAVGKVIASSFPQLECIVFDLPHVV
• ORF Type: internal

Annotations of Ll_transcript_150968

• Blastp: Probable O-methyltransferase 3 from Humulus with 64.39% of identity
• Blastx: Probable O-methyltransferase 3 from Humulus with 64.39% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019432207.1)
• Pfam: O-methyltransferase (PF00891.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;