Protein coding transcript 130931

• Transcript: Ll_transcript_251003
• CDS coordinates: 3-299 (+)
• Peptide sequence: AATFEMKSTFLAALAADGAINEAAISMESLGRAFSPLQQQVKDSLQRQERLVAEIQTKKNEFVLEKNSAGGDSQHREQMLMQLAAGHDAFMELLSNLKE
• ORF Type: internal

Annotations of Ll_transcript_251003

• Blastp: Programmed cell death 6-interacting protein from Xenopus with 41.41% of identity
• Blastx: Programmed cell death 6-interacting protein from Xenopus with 41.41% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (398095)
• CantataDB: -
• Mirbase: -
• Ncbi protein: -
• Pfam: ALIX V-shaped domain binding to HIV (PF13949.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;