Transcript | Ll_transcript_250997 |
---|---|
CDS coordinates | 1-399 (+) |
Peptide sequence | VAMYCAENFPKFLKEVEQYKNGDFLEALKQAFLGFDETLTKPEIISILKELANSKEEGESSDEEEEEVSNLEEEASMPIEELLAKYKSEGGLAIKRIKDGTQPASPYLKARRGGSSSSSAGCSSTSEGSSGSS |
ORF Type | internal |
Blastp | Probable protein phosphatase CG10417 from Sophophora with 46.72% of identity |
---|---|
Blastx | Probable protein phosphatase CG10417 from Sophophora with 46.72% of identity |
Eggnog | Phosphatase(COG0631) |
Kegg | Link to kegg annotations (Dmel_CG10417) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019437529.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer