| Transcript | Ll_transcript_251019 |
|---|---|
| CDS coordinates | 1-306 (+) |
| Peptide sequence | NPIFPILGYSHSDIDNITGSANIIGGYFYRSMTDPCLYGRYLYTDLYAGSIMVGIESPESSRNFSSAKITSRCAHDSPMPCSFVHGSPTPSLGYVYSLAEDN |
| ORF Type | internal |
| Blastp | HIPL1 protein from Arabidopsis with 54.9% of identity |
|---|---|
| Blastx | HIPL1 protein from Arabidopsis with 54.9% of identity |
| Eggnog | Dehydrogenase(COG2133) |
| Kegg | Link to kegg annotations (AT1G74790) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019416400.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer