Protein coding transcript 130942

• Transcript: Ll_transcript_4049
• CDS coordinates: 3-308 (+)
• Peptide sequence: KAGPGVRLSPTDIASKLPTTNPDAPVMLDRILRLLANYSILTYTIHTLNDGKVERLYGLAPVARYLVKNEDGVSLSALSLMNQNKVLMESWYYLKLERCSP*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_4049

• Blastp: Caffeic acid 3-O-methyltransferase from Prunus with 76.84% of identity
• Blastx: Caffeic acid 3-O-methyltransferase from Prunus with 66.67% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019437309.1)
• Pfam: Dimerisation domain (PF08100.10)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;