Protein coding transcript 130943

• Transcript: Ll_transcript_4050
• CDS coordinates: 1-522 (+)
• Peptide sequence: FLNTWANIANGSKQDVLPNPQLISAKLFPPKNVSGFDPRCGIIKENIICKRFVFNASVIEELRAKYNSDIQNEKPPTRVEALSAFIWNRYVAVTREQNESDEKRKLHVIVHAVNLRQKMEPPLPPNSFGNYYRFSMTIIPSFNNGDDEGHGLVKQVREEINKIDKDYIRKLKDG
• ORF Type: internal

Annotations of Ll_transcript_4050

• Blastp: Vinorine synthase from Rauvolfia with 33.71% of identity
• Blastx: Vinorine synthase from Rauvolfia with 33.71% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (CAD89104)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019438324.1)
• Pfam: Transferase family (PF02458.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;