Transcript | Ll_transcript_12694 |
---|---|
CDS coordinates | 2-349 (-) |
Peptide sequence | PLDSPRLSYDGRDMHDSFKSSTKHKELPRLSLDSRQGSFNGVNEGTKSNNLLKGLNKGYGSTSTMVKHLQESETRKRSSSSSVVAKLMGLEGFAGATETCDTPPSMSDEYKQHGSS |
ORF Type | internal |
Blastp | Protein LONGIFOLIA 2 from Arabidopsis with 39.47% of identity |
---|---|
Blastx | - |
Eggnog | NA(ENOG411078I) |
Kegg | Link to kegg annotations (AT3G02170) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019428785.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer