| Transcript | Ll_transcript_12712 |
|---|---|
| CDS coordinates | 23-361 (+) |
| Peptide sequence | MRSCSQENFLSSHLILSSDFVAMASNTNTCSKWTTKKNKQFENALAIYDKETPDRWYKIAMFVGGTTEVEVKSQYEILVEDIKNIESGKIPLPSYNRNGGYSRENISSAEQK* |
| ORF Type | complete |
| Blastp | Transcription factor RADIALIS from Antirrhinum with 58.97% of identity |
|---|---|
| Blastx | Transcription factor RADIALIS from Antirrhinum with 58.97% of identity |
| Eggnog | - |
| Kegg | - |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_006573585.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer