Protein coding transcript 130953

• Transcript: Ll_transcript_46640
• CDS coordinates: 3-479 (+)
• Peptide sequence: SSLLMGFKVSPFSTPISLKTHPFQIQPHSFNIQTKSTLHHNNNNHSYSLVADTDIHQNDSLLQPIIEQDKNLNFNTTTTTNVSEENDDEEEDLAPLWNDGYGTKTIQDFIAEAKEKNKVDNGGPPSWFSPNDCGPPLKNSPTLLFLPGIDGTGLGLTLH
• ORF Type: internal

Annotations of Ll_transcript_46640

• Blastp: Acyltransferase-like protein At1g54570, chloroplastic from Arabidopsis with 59.42% of identity
• Blastx: Acyltransferase-like protein At1g54570, chloroplastic from Arabidopsis with 64.06% of identity
• Eggnog: Acyltransferase(COG0204)
• Kegg: Link to kegg annotations (AT1G54570)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019419255.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;