Protein coding transcript 130954

• Transcript: Ll_transcript_46636
• CDS coordinates: 1-345 (+)
• Peptide sequence: GEVTTIVSKASNKEFKKRDVTIVDKTSTAVHLTLWGSQAEEFDGSNQPVVAVKGGKVNEFGGGKSVSLPASATFQVNPDIPESHQLKGWYDDSGSAASFKLISQRTLGGGTGNDG
• ORF Type: internal

Annotations of Ll_transcript_46636

• Blastp: Replication protein A 70 kDa DNA-binding subunit from Sophophora with 51.38% of identity
• Blastx: Replication protein A 70 kDa DNA-binding subunit from Sophophora with 51.38% of identity
• Eggnog: DNA replication(COG1599)
• Kegg: Link to kegg annotations (Dmel_CG9633)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_015954730.2)
• Pfam: Replication protein A OB domain (PF16900.4)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;