Protein coding transcript 130955

• Transcript: Ll_transcript_230006
• CDS coordinates: 2-610 (+)
• Peptide sequence: INVAAIETTLWSMEWAIAELVNHPNVQNKIRDEISKILKGQQVTESNLNELPYLQATVKETLRLHTPIPLLVPHMNLEEAKLGGYTIPKESKVVVNAWWLANNPTWWKNPEEFRPERFLEEEHETDAVAGGKVDYRFLPFGVGRRSCPGIILALPILGLVIAKLVTNFEMKSAEGSKVDVSEKGGQFSLHIANHSIVLFHPI*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_230006

• Blastp: Cytochrome P450 CYP73A100 from Panax with 81.37% of identity
• Blastx: Cytochrome P450 CYP73A100 from Panax with 76.7% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019452400.1)
• Pfam: Cytochrome P450 (PF00067.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;