Protein coding transcript 130958

• Transcript: Ll_transcript_229997
• CDS coordinates: 1-309 (-)
• Peptide sequence: LGTAKKVTVTVDDSIILHGGGDKKLIEERCEQLRLAMDKSAATFDKEKAQERLSKLSGGVAVFKVGGASEAEVGERKDRVTDALNATRAAVEEGIVPGGGVAL
• ORF Type: internal

Annotations of Ll_transcript_229997

• Blastp: Chaperonin CPN60-like 2, mitochondrial from Arabidopsis with 88.35% of identity
• Blastx: Chaperonin CPN60-like 2, mitochondrial from Arabidopsis with 88.35% of identity
• Eggnog: Prevents misfolding and promotes the refolding and proper assembly of unfolded polypeptides generated under stress conditions (By similarity)(COG0459)
• Kegg: Link to kegg annotations (AT3G13860)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019424599.1)
• Pfam: TCP-1/cpn60 chaperonin family (PF00118.23)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;