Protein coding transcript 130959

• Transcript: Ll_transcript_230001
• CDS coordinates: 3-335 (+)
• Peptide sequence: LSEDSGDLSGSSQVPATDPLAFLRNQPTFQQMRTVVQQNPELLNSVLQQIGQTNPALLQMISNNQEAFVRMLNEPNEGAAAAPAAASRGPADGFEVPVSTQDKEAIDRLKA
• ORF Type: internal

Annotations of Ll_transcript_230001

• Blastp: UV excision repair protein RAD23 homolog B from Homo with 51.49% of identity
• Blastx: UV excision repair protein RAD23 homolog B from Homo with 51.49% of identity
• Eggnog: ubiquitin(COG5272)
• Kegg: Link to kegg annotations (5887)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_014633086.1)
• Pfam: XPC-binding domain (PF09280.10)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;