Transcript | Ll_transcript_183137 |
---|---|
CDS coordinates | 3-371 (+) |
Peptide sequence | KGDFTYVPVDKQTYWQFKMDKVNVGGGKYTFCQQGCQAIADTGTSLIAGPVQEINKLNQALGGTPIMGGEYMIDCNNIPHLPKLDFVIGGKAFSLEGKDYVLRIAQFGKTVCLSGFMGIDIPA |
ORF Type | internal |
Blastp | Lysosomal aspartic protease from Stegomyia with 70.25% of identity |
---|---|
Blastx | Lysosomal aspartic protease from Stegomyia with 70.25% of identity |
Eggnog | aspartic(ENOG410XNV7) |
Kegg | Link to kegg annotations (AaeL_AAEL006169) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_016197480.1) |
Pfam | Eukaryotic aspartyl protease (PF00026.22) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer