Protein coding transcript 130967

• Transcript: Ll_transcript_236206
• CDS coordinates: 1-306 (+)
• Peptide sequence: KEFRVVLPLTVEEYQIAQLYSVAEASKNETGGGEGIEVLKNEPFTNYPLLGGKYSEGQYTYKIYHLASKVPGMIKLLAPKGALEVHEEAWNAYPYCRTVITN
• ORF Type: internal

Annotations of Ll_transcript_236206

• Blastp: Phosphatidylinositol transfer protein beta isoform from Rattus with 68.63% of identity
• Blastx: Phosphatidylinositol transfer protein beta isoform from Rattus with 68.63% of identity
• Eggnog: phosphatidylinositol transfer protein(COG5083)
• Kegg: Link to kegg annotations (114561)
• CantataDB: -
• Mirbase: -
• Ncbi protein: -
• Pfam: Phosphatidylinositol transfer protein (PF02121.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;