Protein coding transcript 130968

• Transcript: Ll_transcript_183239
• CDS coordinates: 3-452 (+)
• Peptide sequence: MGNISGLMFSLIFFSCLIHSFAEFTAEDCWSLGLNKANLLCSSCDQLSKFDLNELKDHCKQCCHKDENADATKRYPKARLEVCTCKFGAYPQIQAFVKSDKPDKFPNLNIRYVRGLDPVIKLLDEDSNIQEVLAIEKWETDTVEEFLRTH
• ORF Type: 3prime_partial

Annotations of Ll_transcript_183239

• Blastp: Selenoprotein F from Danio with 55.56% of identity
• Blastx: Selenoprotein F from Danio with 55.56% of identity
• Eggnog: selenium binding(ENOG4111MSS)
• Kegg: Link to kegg annotations (352923)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (NP_001241444.1)
• Pfam: Sep15/SelM redox domain (PF08806.10)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;