Protein coding transcript 130972

• Transcript: Ll_transcript_13142
• CDS coordinates: 3-374 (+)
• Peptide sequence: YENDFPIPYPTYFHPSNDKEILQWQERMRRMKRTHLFSFAGAPRPNATKSIRSDLIQHCQSSKSCKLLNCYVKNENKCDDPVHVMQVFQSSVFCLQPPGDSYTRRSTFDSILGGCIPVFFNQNS
• ORF Type: internal

Annotations of Ll_transcript_13142

• Blastp: Probable xyloglucan galactosyltransferase GT15 from Arabidopsis with 62.4% of identity
• Blastx: Probable xyloglucan galactosyltransferase GT15 from Arabidopsis with 62.4% of identity
• Eggnog: Exostosin(ENOG410XTFH)
• Kegg: Link to kegg annotations (AT2G31990)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019455307.1)
• Pfam: Exostosin family (PF03016.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;