Protein coding transcript 130975

• Transcript: Ll_transcript_48649
• CDS coordinates: 13-522 (+)
• Peptide sequence: MEDIINSIYHACALAQSLESDLPNLANQPTRLSLSIDEIVETLSDAKERLMILSQHDQTPLSSFAQMMMMPHEMHHQTQMDAISMQEWLSSSYTQTTDQLLQAAMNTIPHQVRTLPETKMMGKEAMEASPSRPRKRKVDLEKRTRMVPAPQFGNTEMPPEDGFTWRKYGQ
• ORF Type: 3prime_partial

Annotations of Ll_transcript_48649

• Blastp: WRKY transcription factor 55 from Arabidopsis with 36.07% of identity
• Blastx: WRKY transcription factor 55 from Arabidopsis with 32.57% of identity
• Eggnog: Transcription factor(ENOG410YNE8)
• Kegg: Link to kegg annotations (AT2G40740)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019416326.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;