Protein coding transcript 130980

• Transcript: Ll_transcript_175632
• CDS coordinates: 24-359 (+)
• Peptide sequence: MDFNFFIQNFSAIGYNKIVSSQEEATFHYSFVPSEAFAGRPFGLHINLAYHDNNGNSFQEAMFNETVQIVELEEGLDGETFFLYVFLAALVVLLLVIGQQTLLSVGKKRTST
• ORF Type: 3prime_partial

Annotations of Ll_transcript_175632

• Blastp: Translocon-associated protein subunit alpha from Pongo with 55.56% of identity
• Blastx: Translocon-associated protein subunit alpha from Bos with 62.07% of identity
• Eggnog: signal sequence receptor, alpha(ENOG410XNTM)
• Kegg: Link to kegg annotations (100173891)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_020202882.1)
• Pfam: Translocon-associated protein (TRAP), alpha subunit (PF03896.15)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;