| Transcript | Ll_transcript_270669 |
|---|---|
| CDS coordinates | 3-305 (+) |
| Peptide sequence | IINFVKPFLKEKIRTRIHVHSSLDSLNEFVPRDMLPEEYGGKAGPIADINRQWYEKMVTYKDWFKEQEKIKADESRRPGKPKTHDDLFGMEGSFKQLSID* |
| ORF Type | 5prime_partial |
| Blastp | Alpha-tocopherol transfer protein-like from Mus with 53.19% of identity |
|---|---|
| Blastx | Alpha-tocopherol transfer protein-like from Homo with 43.08% of identity |
| Eggnog | Transfer protein(ENOG410XRSQ) |
| Kegg | Link to kegg annotations (76080) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019420405.1) |
| Pfam | CRAL/TRIO domain (PF00650.19) |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer