Protein coding transcript 130984

• Transcript: Ll_transcript_16551
• CDS coordinates: 2-586 (+)
• Peptide sequence: GPSINVQDRKNLEYVASVKEMCRLIVVRGFSAFLMYDFLYKLSWEYPKEKKALKIIHSHTNSVINSRRKELEEEEKNAGAAVEDDSGVKKKFAFLDMLLKSSVNGRKLTDEDIREEVDTFMFEGHDTTTSAISFTLYCLTKHPEIQDKVLEEQKQIVGDDFNKPITHRDLQSMKYLENVIKEGLRMYPSVPFYAR
• ORF Type: internal

Annotations of Ll_transcript_16551

• Blastp: Cytochrome P450 4d2 from Sophophora with 43.94% of identity
• Blastx: Cytochrome P450 4d2 from Sophophora with 43.94% of identity
• Eggnog: Cytochrome p450(COG2124)
• Kegg: Link to kegg annotations (Dmel_CG3466)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_003627673.1)
• Pfam: Cytochrome P450 (PF00067.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;