Protein coding transcript 130988

• Transcript: Ll_transcript_266228
• CDS coordinates: 1-330 (+)
• Peptide sequence: LDLTMRETQVMCLSPTRELAVQIQKVILALGDFMNVQCHACIGGTNLGEDIRKLDYGQHVVSGTPGRVYDMIRRRALRTRSVRMLVLDEADEMLNKGFKEQIYDVYRFLP
• ORF Type: internal

Annotations of Ll_transcript_266228

• Blastp: Eukaryotic initiation factor 4A-III from Sophophora with 88.18% of identity
• Blastx: Eukaryotic initiation factor 4A-III from Sophophora with 88.18% of identity
• Eggnog: purine NTP-dependent helicase activity(COG0513)
• Kegg: Link to kegg annotations (Dmel_CG7483)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_020221326.1)
• Pfam: DEAD/DEAH box helicase (PF00270.28)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;