Protein coding transcript 130993

• Transcript: Ll_transcript_260848
• CDS coordinates: 3-608 (+)
• Peptide sequence: PTTPGAEKAPILVEPLKDQTIREGQAVAFRCKIVGKPTPTIKWQKGDKVIKPSKYFQMSKDGDYCTLRISEAFPEDEGVYKCLAENPAGKITAQGKLKVLAPETQEVAPSLTPMKDVIVPEGSPAQFKTTISGKTKSTIQWLREGFLIPESPDFQMITEGNNAILMISTTYEEDSGTFSCRATSSAGQVEQSAKLIVKSKK*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_260848

• Blastp: Titin from Sophophora with 61.39% of identity
• Blastx: Titin from Sophophora with 58.17% of identity
• Eggnog: IG_like(ENOG410XTJ8)
• Kegg: Link to kegg annotations (Dmel_CG1915)
• CantataDB: -
• Mirbase: -
• Ncbi protein: -
• Pfam: Immunoglobulin domain (PF13927.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;