| Transcript | Ll_transcript_174613 |
|---|---|
| CDS coordinates | 53-364 (+) |
| Peptide sequence | MNSGMPELGSKISLISKADIRYEGRLFTVDPQECTIALASVRSFGTEERETKYPVPSQNQVYDYILFRGSDIKDIRVVNTQPLNDPAIVQLSVPPSLGASANFP |
| ORF Type | 3prime_partial |
| Blastp | Protein LSM14 homolog B-B from Xenopus with 57.41% of identity |
|---|---|
| Blastx | Protein LSM14 homolog B-B from Xenopus with 57.41% of identity |
| Eggnog | - |
| Kegg | Link to kegg annotations (734709) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_003516862.1) |
| Pfam | Scd6-like Sm domain (PF12701.6) |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer