Protein coding transcript 131001

• Transcript: Ll_transcript_176720
• CDS coordinates: 2-358 (-)
• Peptide sequence: RASFKGDDAAVKILKGDVSGEINILKKINHTNIIRLSGFCVYKGNTYLVYEFAENDSVDDWLHTMDKKYKNSLSLSWIQRVQIAHDVADALNYLHNYVTPPHVHKNLKSGNVLLDGNFR
• ORF Type: internal

Annotations of Ll_transcript_176720

• Blastp: Protein LYK5 from Arabidopsis with 65.83% of identity
• Blastx: Protein LYK5 from Arabidopsis with 65.83% of identity
• Eggnog: Serine Threonine protein kinase(COG0515)
• Kegg: Link to kegg annotations (AT2G33580)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019434061.1)
• Pfam: Protein kinase domain (PF00069.24)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;