Protein coding transcript 131006

• Transcript: Ll_transcript_240551
• CDS coordinates: 13-411 (+)
• Peptide sequence: MRLSCNGCRILRKGCSDDCTIRPCLEWINSPESQANATLFLAKFYGRAGLLNLINAAPQPLRPAVFKSLMYEACGRIVNPAFGSLGLFWTGEWAQCQAAVDAVLNGSEISAVELSDWQVTPGTKHVFPAHDIR
• ORF Type: 3prime_partial

Annotations of Ll_transcript_240551

• Blastp: LOB domain-containing protein 42 from Arabidopsis with 66.91% of identity
• Blastx: LOB domain-containing protein 42 from Arabidopsis with 66.91% of identity
• Eggnog: lob domain-containing protein(ENOG411150B)
• Kegg: Link to kegg annotations (AT1G68510)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019459804.1)
• Pfam: Lateral organ boundaries (LOB) domain (PF03195.13)
• Rfam: -
• GO: -