Protein coding transcript 131009

• Transcript: Ll_transcript_174642
• CDS coordinates: 2-712 (+)
• Peptide sequence: KNLFCGWYDASLSPKGEEEAANAGKALKQGNYKFDLAHTSVLKRAQNTLGSILKELGQEDIPISKTWRLNERHYGGLTGLNKSETAAKYGEEQVQIWRRSFDTPPPAMDTDHAYYDQIVNDPRYKDEPLKEEFPMFESLKLTIQRTLPYWNDVIIPQLKEGKQILIAAHGNSLRGIVKHLDNLTEDQIMSLNLPTGIPFEYELDENFKPVVSMKFLGDEETVKKAIEAVAAQGKAK*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_174642

• Blastp: Phosphoglycerate mutase 1 from Gallus with 62.29% of identity
• Blastx: Phosphoglycerate mutase 1 from Gallus with 62.23% of identity
• Eggnog: Catalyzes the interconversion of 2-phosphoglycerate and 3-phosphoglycerate (By similarity)(COG0588)
• Kegg: Link to kegg annotations (428969)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_003532836.1)
• Pfam: Histidine phosphatase superfamily (branch 1) (PF00300.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;