Protein coding transcript 131014

• Transcript: Ll_transcript_81647
• CDS coordinates: 33-305 (+)
• Peptide sequence: MTAICKSSMFEAQPNNKLTLNVDKLRQDKLLTRYVENKEDLELQCLYAVQALVTQLEHPQGLIVSIFTTLWEDNLVSTEAFQAWFDKDDPQ
• ORF Type: 3prime_partial

Annotations of Ll_transcript_81647

• Blastp: Eukaryotic translation initiation factor 4 gamma 1 from Homo with 39.56% of identity
• Blastx: Eukaryotic translation initiation factor 4 gamma 3 from Homo with 35.35% of identity
• Eggnog: Eukaryotic translation initiation factor 4 gamma(ENOG410XS4P)
• Kegg: Link to kegg annotations (1981)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_015957605.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;