Protein coding transcript 131020

• Transcript: Ll_transcript_40992
• CDS coordinates: 2-445 (+)
• Peptide sequence: AEQVKKVVVDNLQQDTRVTVLGHVQRGGNPSAFDRVLGCRMGAEAVMALMEADENTEACVITLEGNQAVRLPLMECVKRTKAVAAALAEKQWDKAVDLRGKSFERNLLTYKLLTRLKPPKDAFDEKGKGKEGYTFGIMHIGAPACGMN
• ORF Type: internal

Annotations of Ll_transcript_40992

• Blastp: ATP-dependent 6-phosphofructokinase from Sophophora with 70.95% of identity
• Blastx: ATP-dependent 6-phosphofructokinase from Sophophora with 70.95% of identity
• Eggnog: phosphohexokinase(COG0205)
• Kegg: Link to kegg annotations (Dmel_CG4001)
• CantataDB: -
• Mirbase: -
• Ncbi protein: -
• Pfam: Phosphofructokinase (PF00365.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;