Protein coding transcript 131030

• Transcript: Ll_transcript_160463
• CDS coordinates: 77-562 (+)
• Peptide sequence: MKTPCDVCHFAKQKKLHFQNSTTRSEFVFDIIHVDIWGPVSVPSALGHRYFLTIVDDKSRHTWLFFKKNKSETASHIKSFATLIETQFGTVLKCIRSDNGVEFKMHDFYCTKGIIHQTSCVETPEQNGVVLRKQQHILGIARALMFQASMPKCFWNYATAHA
• ORF Type: 3prime_partial

Annotations of Ll_transcript_160463

• Blastp: Retrovirus-related Pol polyprotein from transposon TNT 1-94 from Nicotiana with 37.04% of identity
• Blastx: Retrovirus-related Pol polyprotein from transposon TNT 1-94 from Nicotiana with 36.84% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019460041.1)
• Pfam: Integrase core domain (PF00665.25)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;