Transcript | Ll_transcript_160463 |
---|---|
CDS coordinates | 77-562 (+) |
Peptide sequence | MKTPCDVCHFAKQKKLHFQNSTTRSEFVFDIIHVDIWGPVSVPSALGHRYFLTIVDDKSRHTWLFFKKNKSETASHIKSFATLIETQFGTVLKCIRSDNGVEFKMHDFYCTKGIIHQTSCVETPEQNGVVLRKQQHILGIARALMFQASMPKCFWNYATAHA |
ORF Type | 3prime_partial |
Blastp | Retrovirus-related Pol polyprotein from transposon TNT 1-94 from Nicotiana with 37.04% of identity |
---|---|
Blastx | Retrovirus-related Pol polyprotein from transposon TNT 1-94 from Nicotiana with 36.84% of identity |
Eggnog | - |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019460041.1) |
Pfam | Integrase core domain (PF00665.25) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer