Protein coding transcript 131035

• Transcript: Ll_transcript_42255
• CDS coordinates: 1-366 (-)
• Peptide sequence: SGVNIAESLLRFATTRQRGLCVLSATGTVADVTLRQADGGTMVFRGQFGIIIMNGLFVPPGSSSSGLTSLNVYLGRGQGRMIGGTVVGPLVAAGPVMVMAATFANAIYVKNPLPNHNNDEDG
• ORF Type: internal

Annotations of Ll_transcript_42255

• Blastp: AT-hook motif nuclear-localized protein 18 from Arabidopsis with 49.06% of identity
• Blastx: AT-hook motif nuclear-localized protein 18 from Arabidopsis with 49.06% of identity
• Eggnog: Domain of unknown function (DUF296)(ENOG410Y9GR)
• Kegg: Link to kegg annotations (AT3G60870)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019442449.1)
• Pfam: Domain of unknown function (DUF296) (PF03479.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;