Protein coding transcript 131036

• Transcript: Ll_transcript_42239
• CDS coordinates: 1-366 (+)
• Peptide sequence: KLLSKSIDAFGQSVEMVLIKYGKNIVNEQFILNRLASATFDIYTSAVVLSRASESLKNGVKTANHEKLMAESWTLEACQRADLNLKSIASGKNLDNFVKMASISKTVCQNNGIAHMNPLNI*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_42239

• Blastp: Very long-chain specific acyl-CoA dehydrogenase, mitochondrial from Mus with 44.26% of identity
• Blastx: Very long-chain specific acyl-CoA dehydrogenase, mitochondrial from Mus with 44.26% of identity
• Eggnog: acyl-CoA dehydrogenase(COG1960)
• Kegg: Link to kegg annotations (11370)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_003519465.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;