| Transcript | Ll_transcript_42268 |
|---|---|
| CDS coordinates | 114-605 (+) |
| Peptide sequence | MNSEKLKKLQSQVRIGGKGTPRRKKKVVHSTQATDDKKLQSSLKKLSVNTIPGIEEVNMIKDDGTVIHFNNPKAQASLAANTFAITGHGENKQITEMLPGILSQLGPEGITQLKRLASSVANAGVNKMTPEDEEDVPDLVENFDEASKAEVAKKDGDDKPKEN* |
| ORF Type | complete |
| Blastp | Transcription factor BTF3 homolog 4 from Danio with 70.51% of identity |
|---|---|
| Blastx | Transcription factor BTF3 homolog 4 from Silurana with 70.51% of identity |
| Eggnog | Component of the nascent polypeptide-associated complex (NAC), a dynamic component of the ribosomal exit tunnel, protecting the emerging polypeptides from interaction with other cytoplasmic proteins to ensure appropriate nascent protein targeting (By similarity). The NAC complex also promotes mitochondrial protein import by enhancing productive ribosome interactions with the outer mitochondrial membrane and blocks the inappropriate interaction of ribosomes translating non-secretory nascent polypeptides with translocation sites in the membrane of the endoplasmic reticulum (By similarity). EGD1 may act as a transcription factor that exert a negative effect on the expression of several genes that are transcribed by RNA polymerase II (By similarity)(ENOG4111JBG) |
| Kegg | Link to kegg annotations (393667) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (NP_001236570.1) |
| Pfam | NAC domain (PF01849.17) |
| Rfam | - |
| GO | - |
Grab and slide to change sequence position
Alignmet by MSA Viewer