Protein coding transcript 131040

• Transcript: Ll_transcript_42260
• CDS coordinates: 1-411 (+)
• Peptide sequence: NKDNDDDYEVGLQSNDYHSTSNYEKMDQKHDEIQCKAIVSKPAPFWKATAVVNGHVTELKLSDYSGRYLVLFFYPQDFSRICPSELIALSDRVSEFRALNTEVVACSVDSYLSHQAWSRTLRSDGGIAIPKMPLLSD
• ORF Type: internal

Annotations of Ll_transcript_42260

• Blastp: Peroxiredoxin-4 from Mus with 59.8% of identity
• Blastx: Peroxiredoxin-4 from Mus with 59.8% of identity
• Eggnog: alkyl hydroperoxide reductase(COG0450)
• Kegg: Link to kegg annotations (53381)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_020223422.1)
• Pfam: AhpC/TSA family (PF00578.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;