Transcript | Ll_transcript_42260 |
---|---|
CDS coordinates | 1-411 (+) |
Peptide sequence | NKDNDDDYEVGLQSNDYHSTSNYEKMDQKHDEIQCKAIVSKPAPFWKATAVVNGHVTELKLSDYSGRYLVLFFYPQDFSRICPSELIALSDRVSEFRALNTEVVACSVDSYLSHQAWSRTLRSDGGIAIPKMPLLSD |
ORF Type | internal |
Blastp | Peroxiredoxin-4 from Mus with 59.8% of identity |
---|---|
Blastx | Peroxiredoxin-4 from Mus with 59.8% of identity |
Eggnog | alkyl hydroperoxide reductase(COG0450) |
Kegg | Link to kegg annotations (53381) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_020223422.1) |
Pfam | AhpC/TSA family (PF00578.20) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer