Protein coding transcript 131043

• Transcript: Ll_transcript_221473
• CDS coordinates: 80-478 (+)
• Peptide sequence: MKREREINITTMTNYLMLLSRGAEFQTTYFNTSNNNRVFECKTCNRQFSSFQALGGHRASHKKQRLMGEERDQMVHDSSPPKPKTHECSICGLEFAIGQALGGHMRRHRVPSSSNGNMQSSITSLSCSVDTKR
• ORF Type: 3prime_partial

Annotations of Ll_transcript_221473

• Blastp: Zinc finger protein ZAT8 from Arabidopsis with 50.85% of identity
• Blastx: Zinc finger protein ZAT8 from Arabidopsis with 49.19% of identity
• Eggnog: Zinc finger protein(COG5048)
• Kegg: Link to kegg annotations (AT3G46080)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019441633.1)
• Pfam: C2H2-type zinc finger (PF13912.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;