Protein coding transcript 131062

• Transcript: Ll_transcript_216585
• CDS coordinates: 67-390 (+)
• Peptide sequence: MAKFDLTSKMGQYLDRHLVFPLLEFLSAKEIYDETELLKAKLDILSKTNMIDYAIDIRKQLYPSEEVPEELKQRRAHVLSQLQELHQEVEPILQIMADDEVMKTMENM
• ORF Type: 3prime_partial

Annotations of Ll_transcript_216585

• Blastp: Eukaryotic translation initiation factor 3 subunit E from Bombyx with 70.09% of identity
• Blastx: Eukaryotic translation initiation factor 3 subunit E from Bombyx with 70.09% of identity
• Eggnog: Component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is involved in protein synthesis and, together with other initiation factors, stimulates binding of mRNA and methionyl-tRNAi to the 40S ribosome (By similarity)(ENOG410XQK5)
• Kegg: Link to kegg annotations (692936)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_003519090.1)
• Pfam: eIF3 subunit 6 N terminal domain (PF09440.9)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;