| Transcript | Ll_transcript_216605 |
|---|---|
| CDS coordinates | 110-436 (+) |
| Peptide sequence | MASSSSTRTQMKWQKLEERKHHKSMAKPSQELSINNVEEDNEKGAYCSNGFATPKGKRFRIPEILTCPPAPKKRRVISKFSSKRSIFFASSDIETFFFNAFRNVSALK* |
| ORF Type | complete |
| Blastp | Cyclin-dependent protein kinase inhibitor SMR13 from Arabidopsis with 56.6% of identity |
|---|---|
| Blastx | - |
| Eggnog | NA(ENOG410ZFT6) |
| Kegg | Link to kegg annotations (AT3G20898) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_007162240.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer