Protein coding transcript 131089

• Transcript: Ll_transcript_86241
• CDS coordinates: 3-386 (+)
• Peptide sequence: RTCVVSEDTLDNAKILVEQYRNRSEPPGTSLEQVIYAKKLYESAFHPDSGEKQNVFGRMSFQVPGGMAITGAMLQFYRTAPAVVFWQWVNQSFNALVNYTNRNAKSPTSTTQRLVAYVTATSSAMGTA
• ORF Type: internal

Annotations of Ll_transcript_86241

• Blastp: Sideroflexin-2 from Bos with 72.03% of identity
• Blastx: Sideroflexin-2 from Bos with 72.03% of identity
• Eggnog: SideroFleXiN(ENOG410YU8V)
• Kegg: Link to kegg annotations (513450)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_016173715.1)
• Pfam: Tricarboxylate carrier (PF03820.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;