| Transcript | Ll_transcript_174568 |
|---|---|
| CDS coordinates | 2-337 (+) |
| Peptide sequence | EHEEKLQKKKEEKPKEGALPVYLLDRDVQSSAKVLSNMIKQKRKEKAGKWDVPIPKVRAQSDNEVFKVFRTGKSKRKGWKRMVTKVCYVGEGFTRKPPKFERFIRPMALRFN |
| ORF Type | internal |
| Blastp | Ribosome biogenesis protein NSA2 homolog from Homo with 73.87% of identity |
|---|---|
| Blastx | Ribosome biogenesis protein NSA2 homolog from Homo with 80% of identity |
| Eggnog | 40S ribosomal protein S8(COG2007) |
| Kegg | Link to kegg annotations (10412) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_006588869.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer