| Transcript | Ll_transcript_174584 |
|---|---|
| CDS coordinates | 2-394 (+) |
| Peptide sequence | GHSGFFRTYKRVSGFFYWEGMRSYVKHYVKTCDVCQRQKYSTLTPGGLLQPLPIPTQIWQDLSMNFISGLPKSRGKDTIMVVVDRLSKYAHFYALGHPFNAKDVAAIFIKEIVKLHGFPATIVSDRDQIF* |
| ORF Type | 5prime_partial |
| Blastp | Transposon Ty3-I Gag-Pol polyprotein from Saccharomyces with 42.19% of identity |
|---|---|
| Blastx | Transposon Ty3-G Gag-Pol polyprotein from Saccharomyces with 42.19% of identity |
| Eggnog | - |
| Kegg | Link to kegg annotations (YIL082W-A) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_015964281.2) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer