Protein coding transcript 131097

• Transcript: Ll_transcript_117707
• CDS coordinates: 3-467 (+)
• Peptide sequence: TLFERCGLHNTGYKVTKHLRATSGIQLPGWVDKAPTWVSNQSSYVGYVAVCDNKEEIKRLGRRDVVIAYRGTSTCLEWLENLRATLTNLPCNMGIENNGLKQNEPMVESGFLSLYNSNNSLHKSLQEMVKEEIGHILEIYGGEPLSLTITGHSLG
• ORF Type: internal

Annotations of Ll_transcript_117707

• Blastp: Phospholipase A(1) DAD1, chloroplastic from Arabidopsis with 65% of identity
• Blastx: Phospholipase A(1) DAD1, chloroplastic from Arabidopsis with 65% of identity
• Eggnog: Phospholipase A(1)(ENOG4111MQ0)
• Kegg: Link to kegg annotations (AT2G44810)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019452054.1)
• Pfam: Lipase (class 3) (PF01764.24)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;