Protein coding transcript 1311

• Transcript: Ll_transcript_358578
• CDS coordinates: 2-415 (+)
• Peptide sequence: FTQNPTLVWMANRDNPVNGKYSKLSLLTTANLVLIDAGKYNIWSTETASTSSVHLKLLNSGNLILQQLEPSLVLWQSFDCHTDSLLPQQQLTRHSTLVSPRSNTNYSSGYYHLFFDNDNVLRLLYNGPEISSIYWPDP
• ORF Type: internal

Annotations of Ll_transcript_358578

• Blastp: Putative receptor protein kinase ZmPK1 from Zea with 38.97% of identity
• Blastx: Putative receptor protein kinase ZmPK1 from Zea with 38.97% of identity
• Eggnog: Serine Threonine protein kinase(COG0515)
• Kegg: Link to kegg annotations (542378)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_014630712.1)
• Pfam: D-mannose binding lectin (PF01453.23)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;