Transcript | Ll_transcript_175589 |
---|---|
CDS coordinates | 1-321 (+) |
Peptide sequence | AESKTSKPKSSLSKDPQSVAAKNRRERISERMKVLQELVPNGSKVDLVTMLEKAISYVKFLQLQMKVLATDEFWPVQGGKAPDISQVKEAIDAILSSQRERSSSTK* |
ORF Type | 5prime_partial |
Blastp | Transcription factor bHLH83 from Arabidopsis with 83.17% of identity |
---|---|
Blastx | Transcription factor bHLH83 from Arabidopsis with 86.81% of identity |
Eggnog | Transcription factor(ENOG410YWET) |
Kegg | Link to kegg annotations (AT1G66470) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019439477.1) |
Pfam | Helix-loop-helix DNA-binding domain (PF00010.25) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer