Protein coding transcript 131106

• Transcript: Ll_transcript_175585
• CDS coordinates: 3-389 (+)
• Peptide sequence: KSLSAQRRIDLWRARCQGPIFQEIANMAAALRSAVATARPVVEKNLKIALHYAKAELTPPKPTELGQVAKGFNNILTSFRTGRYKQLTVKEAWLNVLVATEVACWFFIGECIGRRHLVGYYVPPTHPH*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_175585

• Blastp: ATP synthase subunit g, mitochondrial from Mus with 49.49% of identity
• Blastx: ATP synthase subunit g, mitochondrial from Pongo with 55.56% of identity
• Eggnog: Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core, and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Part of the complex F(0) domain. Minor subunit located with subunit a in the membrane(ENOG4111TZ1)
• Kegg: Link to kegg annotations (27425)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_003529513.1)
• Pfam: Mitochondrial ATP synthase g subunit (PF04718.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;