Protein coding transcript 131118

• Transcript: Ll_transcript_109759
• CDS coordinates: 39-494 (+)
• Peptide sequence: MKFNKLVTSSRSKNRKRHFTAPSHIRRRLMSAPLSKELRQKYNVRTMPIRKDDEVQVVRGHYKGQQVGKVVQVYRKKFVIYIERIQREKANGASVYVGIHPSKVVIVKLKMDRDRKKIIDRRAAGRLAALGKDKGKYTEDSAAAAAAVETS*
• ORF Type: complete

Annotations of Ll_transcript_109759

• Blastp: 60S ribosomal protein L26 from Littorina with 75.86% of identity
• Blastx: 60S ribosomal protein L26 from Littorina with 84.68% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_016201632.2)
• Pfam: Ribosomal proteins L26 eukaryotic, L24P archaeal (PF16906.4)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;