Protein coding transcript 131122

• Transcript: Ll_transcript_109769
• CDS coordinates: 303-896 (+)
• Peptide sequence: MEGNYVNRNSHREDHSFGFEEHTWGTSWPARNYACSFCKREFRSAQALGGHMNVHRRDRARLRSSISSWVSECPKPNPSTTKPNNSSSPLSDELLNCTHRSSHCSPYLTLSSTSGDKKPRLASSSQQLPPLSLQSMEIKMAKKTTRSTFDVEELKGCEEEDEGKIFKNSSDHNITLDLGIGLFKQEEKLDLELRLGH*
• ORF Type: complete

Annotations of Ll_transcript_109769

• Blastp: Transcriptional regulator SUPERMAN from Arabidopsis with 40.1% of identity
• Blastx: Transcriptional regulator SUPERMAN from Arabidopsis with 36.22% of identity
• Eggnog: Transcriptional regulator(ENOG410Z0H6)
• Kegg: Link to kegg annotations (AT3G23130)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019439173.1)
• Pfam: C2H2-type zinc finger (PF13912.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;