Transcript | Ll_transcript_109770 |
---|---|
CDS coordinates | 408-1001 (+) |
Peptide sequence | MEGNYVNRNSHREDHSFGFEEHTWGTSWPARNYACSFCKREFRSAQALGGHMNVHRRDRARLRSSISSWVSECPKPNPSTTKPNNSSSPLSDELLNCTHRSSHCSPYLTLSSTSGDKKPRLASSSQQLPPLSLQSMEIKMAKKTTRSTFDVEELKGCEEEDEGKIFKNSSDHNITLDLGIGLFKQEEKLDLELRLGH* |
ORF Type | complete |
Blastp | Transcriptional regulator SUPERMAN from Arabidopsis with 40.1% of identity |
---|---|
Blastx | Transcriptional regulator SUPERMAN from Arabidopsis with 35.57% of identity |
Eggnog | Transcriptional regulator(ENOG410Z0H6) |
Kegg | Link to kegg annotations (AT3G23130) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019439173.1) |
Pfam | C2H2-type zinc finger (PF13912.5) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer