Transcript | Ll_transcript_109758 |
---|---|
CDS coordinates | 3-413 (+) |
Peptide sequence | GSKKALIYEFMCNGSLEKFIHNKVETETKPSLSWDKMYQIAIGIARGLEYLHKGCNTRILHFDIKPHNILLDENYGPKISDFGLAKLSTREKSNVSMSNARGTIGYVAPEVWNRSFGGVSHKSDVYSYGMMLLEMVG |
ORF Type | internal |
Blastp | Rust resistance kinase Lr10 from Triticum with 63.24% of identity |
---|---|
Blastx | Rust resistance kinase Lr10 from Triticum with 63.24% of identity |
Eggnog | - |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_015947230.2) |
Pfam | Protein tyrosine kinase (PF07714.16) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer