Protein coding transcript 131124

• Transcript: Ll_transcript_109758
• CDS coordinates: 3-413 (+)
• Peptide sequence: GSKKALIYEFMCNGSLEKFIHNKVETETKPSLSWDKMYQIAIGIARGLEYLHKGCNTRILHFDIKPHNILLDENYGPKISDFGLAKLSTREKSNVSMSNARGTIGYVAPEVWNRSFGGVSHKSDVYSYGMMLLEMVG
• ORF Type: internal

Annotations of Ll_transcript_109758

• Blastp: Rust resistance kinase Lr10 from Triticum with 63.24% of identity
• Blastx: Rust resistance kinase Lr10 from Triticum with 63.24% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_015947230.2)
• Pfam: Protein tyrosine kinase (PF07714.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;